بسكوت ال10 دقائق الاقتصادى ????
Hello friends ????
I am happy to share my recipes with you. I love cooking very much. I love making sweets. Eastern and western food. I love trying new recipes.Oriental sweets are my specialty.pastries. appetizers.soups. Main dishes.the authorities.sandwiches. pasta. Dieting recipes. Western sweets. Recipes around the world.food across the country. Halal food only.cake.chocolate. Ganache. fruits.cheese cake. cookies.White chocolate sauce. Pecan caramel sauce. Lotus butter dessert.ice cream.Pie.Pasta and white sauce. Mini pizza. toast.yogurt.Apple.berries.the strawberry.Orange cake.Sweetened condensed milk cake.Dates and sesame pies. kahk Cakes.Mango cheesecake Blueberrypudding.Macaron.Pound.Brownies. cupcake.pineapple.
Tiramisu.Panacotta.Dates.Coffee.candy. Tortilla.crepe.Turkish baklava. Puff pastry. Died milk jam.soufflé.Glash.kiwi.Crisps. Mmlhat.star anise Rice with milk. granola. Chia pudding.Lazy cake.swissroll.fudge Peanut Butter.Tart.Marble.Honey biscuit. waffleApple chili.Lemon custard.Raffaello balls.Healthy cookies.Sesame tahini. Almonds.Nut.Nut.cashews.PistachioChewy jelly candy.Jelly cola.trilecha.pasties.Biscuit formation. cake decoration.Cinnabon. cinnamon.Creme caramel.Sham dates.dairy.donut.cream.Marshmallow.Kojak. Egg cream.Macron.Eggs.Shakshouka. supermarket products.Oreo.cake.lotus. Biscuits.cookies.English cake, pomegranate dessert.candies.Rizzo Kentucky.McDonald's. pate.Croissant and round.Basbousa semolina.Oatmeal cake.Wheat.pancake.Red velvet.coconut.raisins.Muffin.breakfast. dinner.lunch. Fish soup.Shrimp.oyster. squid.cackerel.Burger.Lamb.Cows.Camel. buffalo.Ducks.chicken.Liver. Sausage.the bathroom.fish.the birds.Bluebeef. Strips. Builder.Pasta rice.Dairy products. Mozzarella.Kiri cheese,white cheese.yellow cheese cream cheese Butter.vegetables. zucchini; Bazanjan.beet.cauliflower.flower . cabbage.Carrots.Sweet potatoes.potatoes. Onion, bulgur salad.Figs.Watercress. avocado.Coleslaw.Pumpkin salad. mushrooms.Grilled goat cheese.Rice kofta. Fajita caesar dressing.vegetable soup. chicken.vermicelli.Noodles recipes.Taco soup.Maize .celery.broccoli lentils spinach.squash.Shrimp.Hummus and cumin.Creamy fish.plate of meat.manakish. Pies.urinate brick.Fattah.Doritos.Chipsy. Bake Rolls.Pringles.Calamari.Mexican taco.Cereal. keto Taco soup.Low carb.without flour. Sugarless.Apricot jam.Cereals and legumes. cowpea.beans.Linum seed.Quinoa.wheat germ.Chia seeds.Fennel.peas.chickpeas. Beans.Nutella.Sushi.Mochi.Mucha. recipes.Korea .Spain.Japan.Iceland.Africa. Saudi Arabia. Morocco.Algeria.Oman .Egypt. Palestine.the two seas.Qatar.Kuwait. Pakistan.The Philippines.Mongolia.Myanmar. Indonesia.Singapore.Afghanistan. Bangladesh.Nepal India.Vietnam.Malaysia. Tunisia .Syria.Iraq.Yemen.Iran.Jordan. Ghana.Croatia.Macedonia.Slovakia.Bsusna. Albania.Bulgaria.Hungary.Belgium.Denmark. Belarus.Russia.France.olland .Portugal. Switzerland.Sweden.Greece.Britain
مرحبا بالاصدقاء ????
يسعدنى مشاركة وصفاتى معكم انا احب الطبخ كثيرا احب صناعة الحلويات الطعام الشرقى والغربى احب تجربة الوصفات الجديده الحلويات الشرقيه من اختصاصى المعجنات المقبلات الشوربات الاطباق الرئيسيه السلطات السندويشات المكرونه وصفات الرجيم الحلويات الغربيه وصفات حول العالم طعام مختلف أنحاء البلاد الطعام الحلال فقط كيك شيكولاته جناش فواكه تشيز كيك كوكيز صوص الشيكولاته البيضاء بيكان صوص كراميل حلى زبدة اللوتس آيس كريم فطيره مكرونه وايت صوص مينى بيتزا خبز توست زبادى التفاح التوت الفراولة كيك البرتقال كيك الحليب المكثف المحلى فطائر التمر والسمسم الكحك كعك تشيز كيك مانجو بودنج التوت الازرق ماكرون باوند براونيز كب كيك اناناس تراميسيو باناكوتا التمر القهوه كاندى تورتيلا كريب بقلاوه تركيه بف باسترى توفى مربى الحليب سوفليه جلاش كيوى مقرمشات مملحات الينسون ارز بحليب جرانولا بودنج ليزى كيك سويسرول فادج زبدة الفول السوداني تارت بسكويت العسل وافل چيلى التفاح كاسترد الليمون رفايلو كوكيز صحى طحينة السمسم اللوز البندق الجوز الكاجو الفستق جيلى كولا. تريليتشا فطائر اللحم تشكيل البسكويت تزيين الكيك سينابون القرفه كريم كراميل بلح شام ملبن دونات قشطه مارشميلو كوجاك كريمه البيض ماكرون بيض شكشوكه منتجات سوبر ماركت اوريو كيك لوتس بسكوت كوكيز انجلش كيك.حلوى الرمان سكاكر ريزو كنتاكى ماكدونالدز باتيه كرواسون ودائرى بسبوسة السميد كيك الشوفان القمح بان كيك ريد فلفت جوز الهند زبيب مافن. فطور عشاء غداء شوربه سمك جمبرى محار سبيط كاكريل برجر لحم الخروف البقر الجمل الجاموس البط الدجاج كبده سجق الحمام الأسماك الطيور بلوبيف استربس بانيه الارز الباستا منتجات الألبان موتزريلا جبن كيري.جبن كريمى الزبدة الخضار الكوسا بازنجان شمندر قرنبيط زهره كرنب جزر بطاطا حلوه بطاطس بصل البرغل التين الجرجير الافوكادو كولسلو سلطة القرع الفطر الماعز المشوى كفتة الارز فاهيتا صلصة السيزر شوربة الخضار الدجاج الشعيرية وصفات نوديلز شوربة التاكو الذره الكرفس البروكلى العدس السبانخ يقطين جمبرى حمص والكمون السمك بالكريمه صفيحة لحم مناقيش فطائر تبوله لبنه فته دوريتوس شيبسى. بيك رولز برنجلز كلمارى تاكو مكسيكي كورن فلكس كيتو لو كارب بدون طحين بدون سكر مربى مشمش حبوب وبقول لوبيا فاصوليا بذر الكتان كينوا جنين القمح بذور الشيا بازلاء الحمص الفول نوتيلا سوشى موتشى موتشا
Christmas Apricot Wheat Germ Muffins
Preparation. Preheat oven to 400°F. Coat 12 muffin cups with cooking spray. Combine apricots and ¼ cup orange juice in a small bowl. Whisk whole-wheat flour, all-purpose flour, ¾ cup wheat germ, baking powder, baking soda and salt in a large bowl. Whisk eggs and brown sugar in a medium bowl until smooth.Healthy Apple Muffins. Tried these and loved them. I believe there's a difference between muffins and cupcakes. Don't expect a super-sugary and sweet ...Find and save ideas about Apricot muffins on Pinterest. | See more about Scone recipes, Breakfast scones and Baking scones.These muffins are best served warm, so reheat before serving if you've made them a day or two ahead. Wrap the muffins in aluminum foil, and heat at 350° for ...Oat Bran, 539 Oatmeal-Date, 539 Orange, Frosted, 541 Cottage Cheese Salad, ... 123 Spiced, 612–13 Turtle Bars, 607 Wheat Germ Apricot-Nut Balls, Unbaked, ... 548–49 Chocolate Peanut Butter Balls, 555–56 Christmas Holly Wreaths, ... 181 Cornflakes Crumbs, 34 Cornflakes Macaroons, 537 Cornmeal Muffins, 376 ...Important note. Wheat germ contains gluten and many pediatric experts recommend that it is not introduced to your baby until he is AT LEAST 6 months of age.565 Delicious Slow-Cooker, Stove-Top, Oven, and Salad Recipes, Plus 50 ... Chip Muffins, 59 Triple Chocolate Cake and Sauce, 239 Wheat Germ Zucchini ... Wheat Zucchini Muffins, 58 Zucchini Brownies, 259 Chocolate, White Apricot and ... 87 Zucchini Garden Chowder, 92 Christmas Popcorn, 27 Cilantro Aloo Gobi with ...Swedish Spritz Traditional spritz cookies are made at Christmas. ... 2 cups flour 1/2-cup wheat germ 1-teaspoon cardamom seasoning 1-teaspoon salt 1/2-cup ... I use apples, cranberries, prunes, dates, raisins, and apricots, whatever I have.
10 minutes Broken Wheat Recipe #shorts #motichoorladdu #sweet #laddu #daliya #quickrecipe
#trending #viral #sweet #youtubeshorts #shorts #shortsvideo #cooking #ladoo #laddu #motichur #motichoorladdu #daliya #brokenwheat #rava #sooji #soojiladdu #reels #youtubeshorts #shortsvideo #shortsyoutube #shortsviral #viral
Please like share and subscribe
నోట్లో వెన్నలా కరిగిపోయే లడ్డు రెసిపి|Sweet recipes in telugu|Instant Laddu recipe|Wheat Rava Laddu godhuma rava kesari in telugu| godhuma rava sweet| rava kesari in telugu| godhuma rava halwa| prasadam recipes in telugu| godhuma rava recipes| wheat rava sweet recipes| godhuma rava sweet recipes in telugu| godhuma rava prasadam telugu| godhuma rava kesari| erra nooka prasadam in telugu| simple sweet recipes in telugu| kesari recipe in telugu| Kesari laddu recipe in telugu| godhuma rava prasadam| godhuma rava halwa in telugu| doddu rava sweet| erra nuka prasadam| rava sweet recipes in telugu| rava prasadam in telugu| halwa recipe in telugu| bansi rava sweet recipes in telugu| Lapsi sweet recipe in telugu| Lapsi in telugu| Mothi choor Laddu in telugu
जब भी कुछ मीठा खाने का मन हो तो झटपट से बनाये मुँह में घुल जाने वाली केरल की मिठाई।sweet Recipe
#instantsweetrecipes
#vinayakachavithiprasadamrecipes
High Protein Healthy Energy Balls
High Protein Healthy Energy Balls is a free cooking video by That Vegan Mom, which is under the creative commons license with the attribution of That Vegan Mom as the original author of this video.
They are such a quick and healthy snack packed with lots of nutrition ! Feel free to modify and adjust recipe to your liking… I always make these different and I encourage you to CUSTOMIZE it to what you have on hand :)
Here is what I used in the video:
Recipe # 1
Walnut Brownie Energy Balls
Ingredients used:
1 can Black Beans (drained and rinsed)
1.5 scoops Vega Chocolate Protein Powder (sub for any other protein, flax meal, or cacao)
Almond Milk (add splashes as needed to blend and to reach desired consistency)
3 Dates, pitted (try to use soft and fresh ones ! )
about 1 Tsbp Cacao or more if you would like :)
ADD INS: Sweet Drops (vanilla) or sweetener of choice and WALNUTS
TOPPING : Hemp seeds
Recipes # 2
Chocolate Chip Oatmeal Energy Ball
Ingredients Used:
1 can Chickpeas (drained and rinsed)
1/2 cup Wheat Germ
1 cup Old Fashioned Oats
Maple Syrup (about 3-4 Tbsp)
*I added agave also so it would hold together, but you can just add more maple syrup
1-2 Tbsp Cinnamon
Assorted Raisins
1-2 tbsp Almond Butter
Enjoy Life Vegan Chocolate Chips
Thank you so much for watching!
Music Credit
Nicolai Heidlas-Pacific Su